How to Predict Protein Properties
1. Function Description
Enter a protein amino acid sequence, and the system can predict the optimal pH condition of the corresponding protein, helping users determine whether the target protein is more suitable for acidic, neutral, or alkaline environments.
After the user confirms the task, the system will automatically complete the prediction and generate a CSV result file saved to My Cloud Drive. The results can be used for protein property analysis, enzyme engineering, and experimental condition optimization.
2. Case Demonstration
2.1 Optimal pH Prediction for Protein Sequences
2.1.1 Input Requirements
Predict the optimal pH for the sequence: 'MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE'
After checking the information, confirm the task, and the agent will generate the corresponding results.
Once the results are successfully generated, the resulting CSV file will be automatically saved to My Cloud Drive. The file can be downloaded either from the page interface or from cloud storage.